PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10016413
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 281aa    MW: 30962.6 Da    PI: 7.1929
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10016413genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.21.6e-121464148
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++ Ede+l+++     g+   +W  Iar  g+ R++k+c++rw +yl
      Lus10016413 14 RGLWSAAEDEKLKKYMSSNTGRrlgCWGEIARNAGLQRCGKSCRLRWINYL 64
                     788**********************************************97 PP

2Myb_DNA-binding46.21.1e-1470114147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++++ E+ l+++++ +lG++ W+ Ia++++ gRt++++k++w++ 
      Lus10016413  70 RGPFSPYEQHLILHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNTT 114
                      89********************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.341964IPR017930Myb domain
SuperFamilySSF466891.95E-2412111IPR009057Homeodomain-like
SMARTSM007171.9E-81366IPR001005SANT/Myb domain
PfamPF002491.4E-101464IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-191571IPR009057Homeodomain-like
CDDcd001679.73E-71764No hitNo description
PROSITE profilePS5129423.78465119IPR017930Myb domain
SMARTSM007175.6E-1369117IPR001005SANT/Myb domain
PfamPF002499.4E-1470114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-2572118IPR009057Homeodomain-like
CDDcd001674.99E-790115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MSNDSNTISS KLRRGLWSAA EDEKLKKYMS SNTGRRLGCW GEIARNAGLQ RCGKSCRLRW  60
INYLRPDLKR GPFSPYEQHL ILHLHSLLGN RWSQIAARLP GRTDNEIKNF WNTTLKKRTK  120
MTTMLTSSTT TNYNEGSTST ATGGSSMSTS LEHHHPRDTM LIEGQGINND VKIPLFSDHH  180
HGVMMMSSNH HTMSSGVGCT GFESAAASTI TATTASSSGF HPLNGCINHH DGDPLMAASV  240
LDGCDDGDQI ILSSGGEDSN YNIVNYDNYC NWDIMEDLFI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-22511918128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006592969.11e-61PREDICTED: transcription factor MYB86-like
TrEMBLA0A0B2QHP31e-61A0A0B2QHP3_GLYSO; Transcription factor MYB46
TrEMBLI1LVD91e-61I1LVD9_SOYBN; Uncharacterized protein
STRINGGLYMA12G36630.14e-61(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.11e-51myb domain protein 83